Today's Picks
LOGWELL.COM Seo 186 PODGAMER.COM Seo 170 PETITO.COM Value 134 BLAZES.COM Demand 130 DAVESHOWS.COM Brandable 86 ARUKAPET.COM Watch 85

Find expired domains worth checking today

6,000 matching 6,000 tracked Updated daily Traffic • Age • Bids • SEO
Login unlocks full table
Filters
Common
Auction
Domain quality
Majestic
Semrush
6,000 of total 6,000 domains Page 117 of 240
Domain FAV Len SEO Type End Price Bids Age Views Val TF CF MJ BL MJ RD Vol
NATURALCARPSOLUTIONS.COM 20 BuyNow 0m $11 0 2 0 $17 0 0 0 0 0
MYHONEYCOMBSHADES.COM 17 Bid 0m $1 0 1 0 $17 0 0 0 0 0
MULTITRANSPORTML.COM 16 Bid 2d 19h 8m $1 0 4 0 $17 0 0 0 0 0
MIDNIGHTDRIFTRC.COM 15 BuyNow 0m $40 0 1 0 $17 0 0 0 0 0
MDANIGAMES.COM 10 BuyNow 0m $5 0 2 0 $17 0 0 0 0 0
MARATHONMONTHCHALLENGE.COM 22 BuyNow 0m $40 0 4 0 $17 0 0 0 0 0
LAKEFORESTCARPETCLEANINGEXPERTS.COM 31 Bid 1d 20h 13m $1 0 14 0 $17 0 5 27 22 0
KOAME.ONLINE 5 Bid 1d 22h 20m $1 0 1 0 $17 0 0 0 0 20
KIDNAPPINGJESUS.COM 15 Bid 0m $1 0 4 0 $17 0 0 0 0 0
KELLERWILLIMASREALTYLASVEGASPAULCARUSO.COM 38 Bid 3d 23h 7m $1 0 8 0 $17 0 0 0 0 0
JOAOMARCELLO.COM 12 BuyNow 0m $30 0 3 0 $17 0 0 0 0 0
INVESTMENTDIAMOND.INFO 17 BuyNow 0m $40 0 8 0 $17 0 8 29 19 0
IBEROSTARVACATIONSCLUB.COM 22 BuyNow 0m $5 0 1 0 $17 0 0 0 0 0
HOMERENTALGUIDE.DIGITAL 15 BuyNow 0m $11 0 1 0 $17 0 0 0 0 0
HOMEFITROOTS.COM 12 Bid 21h 5m $1 0 1 0 $17 0 0 0 0 0
HELLONEBULA.ONE 11 BuyNow 0m $40 0 1 0 $17 0 0 0 0 0
HEALTHYXCHILE.COM 13 Bid 2d 22h 52m $1 0 1 0 $17 0 0 0 0 0
GTAD.ONLINE 4 Bid 7d 23h 58m $1 0 1 0 $17 0 0 0 0 50
FOLLOXSONIC.COM 11 BuyNow 0m $5 0 1 0 $17 0 0 0 0 0
FARMASIMENTOR.COM 13 Bid 7d 22h 40m $1 0 1 0 $17 0 0 0 0 0
FABRIQUEACLIENTS.COM 16 BuyNow 0m $40 0 1 0 $17 0 0 0 0 0
EPIC-X.TECH 6 Bid 1d 21h 19m $1 0 1 0 $17 0 0 0 0 0
EMERALDLUXESTHETICS.COM 19 Bid 3d 19h 45m $1 0 3 0 $17 0 0 0 0 0
DROGEN-VERSAND24.COM 16 Bid 1d 20h 15m $1 0 10 0 $17 0 0 0 0 0
DIRECTMEDIAPROMO.NET 16 Bid 0m $1 0 1 0 $17 0 0 0 0 0
SEO Links
Free Services

Using this web app is free. Our service includes a list of expired domains with traffic, domain age, value and more...

Register and Get Full Access

Sign up today to unlock exclusive features, advanced filters, and premium domain insights. It's all free...

About 1 Million Premium Domains

Every day, we update our list with about 1M expired domain names to help you find the best opportunities.

FAQ

Quick answers for new users

Gaining authority with a new website among millions of websites is tedious work. It demands a tremendous amount of time and diligence. It's a time-consuming process that does not guarantee return on effort. Research indicates that more than 80% of all websites are very small or do not get traffic from visitors. Only 9% of all websites receive traffic from Google. While paid services sell traffic, they are costly and not always efficient.

The challenge with a new website is that it has zero backlinks and no search engine visibility. However, expired domains can help. Millions of domains expire daily, and while not all are valuable, many have built authority. Some have quality backlinks, age, or existing traffic. Various tools can measure a domain’s authority.

What can I do with expired domains?

  • Use them for business: If you're starting a niche site or store, an expired domain with relevant history can boost your SEO ranking.
  • Create a Private Blog Network (PBN): A PBN is used to pass authority to a single website to improve rankings.
  • Redirect to your website: Expired domains with history can be redirected to your new website to pass on SEO value.
  • Flip the domain: Some expired domains have significant marketplace value and can be sold for a profit.

SEO stands for Search Engine Optimization, which involves optimizing websites for better rankings. Search engines crawl websites to determine their content and relevance. Based on domain authority and other metrics, a website's placement on search engine results pages (SERPs) is determined.

  • Domain Length: Shorter domains are easier to remember and more likely to get clicks. Popular domain lengths range from 6-14 characters.
  • Domain Extension: .com is the most valuable, followed by .net and .org. Specialized extensions like .ai or .tech may be better for niche industries.
  • Domain Age: Older domains hold more SEO value, as search engines favor them over new domains.
  • Godaddy Valuation: Some platforms estimate domain values based on traffic, authority, and other factors.
  • Backlinks: The number of quality backlinks a domain has is a crucial SEO metric.
  • Traffic: Some expired domains continue receiving traffic, though exact data can be hard to find.

The best expired domain aligns with your goals and budget. Search for domains using your main keyword, sort by different metrics, and analyze SEO factors. Domains from GoDaddy Auctions are listed in different formats such as Bids, Offers, and Buy Now. Some expired domains are highly sought-after, driving prices up to $50,000.

We cannot guarantee that our data is 100% accurate, but all information is sourced from trusted providers such as GoDaddy, Majestic, and Alexa.

Check the domain history: Some expired domains may have been used for spam or black-hat SEO tactics. Use tools like The Wayback Machine to check past usage.

Check if the domain is banned from Google: Google may de-index domains that violate its policies. Be cautious and verify before purchase.

Beware of scammers: Some scammers reactivate expired domains to deceive users and steal personal data.

Get hand-picked domains by email

Leave your email to receive hand-picked expired domain opportunities and important updates.

No spam.

© 2026 expiredomains.net. All rights reserved.